@ fg@H$J  J$@aH`V`AVH2$ BH (I`H$J  @$J  @$J $ H $ H(a$J  LH IJ$@$'&@^ HPa>$```````hhhhhh01234577<=>?89:;<<$HxI`$H @lqh`N"BCZRR2 J#h LYZb@02~2< H IA!H@HX> {J  @$J  @$J $I @"A<RAN*N J(K$ JL `H@"A<RAN*N J(K$ JL `H I JI0R0R20J `DHPH`H` 1o#flx! 2@1}w@T01uw 1!3"2 00@1ew -!/". ,0@ 2Uw )!+"* (0@T2Ew %!'"&@28w !" 0@2(w@ow@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@`1o fl@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@`1ov fl@AHIf1ON2 hI\ 2"              &qp10>B"2.6* &@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@`1o,fl`N0ofl@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@0`ofl&l:9>=<;'&l&524130#"! &lw&l@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@8`ofl&l:9>=<;'&l&524130#"! &lw&l@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@@`ofl&l:9>=<;'&l&524130#"! &lw&l@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@H`o?fl&l:9>=<;'&l&524130#"! &lw&l@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@P`ofl&l:9>=<;'&l&524130#"! &lw&l@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@X`ofl&l:9>=<;'&l&524130#"! &lw&l@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@``o=fl&l:9>=<;'&l&524130#"! &lw&l@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@h`ofl&l:9>=<;'&l&524130#"! &lw&l@{0d@;0@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@o{fl&l:9>=<;'&l&524130#"! &lw&l@{0d@;0@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@ofl&l:9>=<;'&l&524130#"! &lw&l`xC 2J |@U^O0 d0NJP "]0dMxCIM !Jh | ldJ $PJ$H @8J$I a\n$"l$@8L$8`$`$`J PIJ qH#J PboP1H@CcxJ 80P0H%8CQ`h``03J yH#JC 1H@2qCJ P!@0H$PT /8 2!C C l/C(|"2g #dPL |cRUR!QgNg gO`2 qP`+C8 `S0x` J |J R2JV` >RJPJ 8R`2A 2K |coB:0L2[`HTT"HQ  2Q DѼ0JJ |@ J ~Ha`2BQ(|D ` 2Ѽ 2ZPH QI (|J `м¼ ᬢѼ'20J @Zg  0NJ0 |N `@PVP0O 2TZL 0JN0 N*"03Ne$ `  [P T 0aNd T 0yN w T #~0N |P0O2L |ZZJ 0N `@`V` PcT JѬм 0`M"0Zd`` cT  @ |AP 2N̬LL2Al̬LacU!dM JN N."6Ne( `  [Q! !T aN n T yN w !T &~ N |Q g 0O2J |ZԬTacUGRz`  ତ`2/dE(|2 2LacUGRz` 2 2J`0Z2JP¼հZ!2 հ  20N0No `@PVP0O2ZM 0JN0 N+"03Ne% `  [P !T 0aN n T 0yN w !T #~0N |P0O2J |ZA 0N `@PVP HcT AȬ༡̼0 dJM ` |@Q I T cU O T &d0O2K |0ZZQ2ԬTacUGRx`  `2/d`T Bl`T oJgJ | OQ   T &d O/XCTX/H |caATz`AR JD0 H(Q|Q8 d!Pg!U0z8 80 H |D}K pP' I.P |JPP J |8  'RP8`GT `@`HSQ7P"PPg"QTARMQ0<8 0G2(PH9R |(PJDHy`  `J1 ๠gcHU2`I(V`x`Z)h QD0@d8IJ 8   J 4J 0HP J |cPTPRx` `<, ȼ2ZPJP0 ZA0ȼ2J`I0¼2 (|JѼPZ 2ZPJPȼ J |DZJJ`ID0@d 000`[ 0&2c``ocK0AU 0Yd =0cU 2J | ZH @LH0P2PH#AcTHjP0d2!RJI |ZP`I V`! 90Ѽ h`C0HbDacAT@ |0^I |P PL(P0d⹂O0g aᬢ\2 ѼCl$` 2K22"lAl@`  a `AlAl C00PH |22!RJP@I V@ (PѼD2  :)P72'2080g a\2 ѼCl$` 2K22"lAl@`  a `AlAlK C00F 02`C b@L2c2oZT`cTQ`20 0g a "` 2S22!l"l@X` a  C00B0C0$ gRz` `2I V`DZ20JHZPJPA0@dz 2I8V`ZPJPD0@d 00`^@` 04x` `0Yd` `cU4Pd% (0`B%2000 o$QCgUgL0Ry` 7P8D0Rc`TR02P2JIPJP`IV`0'2c`T Ry`  2JZP`I V`B0@dD0@d0 !Pg0!JTJ |80cXU0@ 2`.D ,T2oP(TZ0 0g a ` T2``` "l `a `` D0`VD0 0` 2oI H 0L2ZPH`cTg cTg( (   0 8 J | J  J |/ ` J ` `2C:GX@C 2I h)ANg^HXX@C 2AN^HXX@C 2AN^HXX@C 2AN^HXX@C 2AN^HXX@C 2AN^HXX@C 2AN^HXX@C2ANQ^HX/ X@C 2J h)ANg^HX/C02:OX@C 2I h) 0AN^XX@C 2 0ANg^XX@C 2 0AN^XX@C 2 0AN^XX@C 2 0AN^XX@C 2 0AN^XX@C 2 0AN^XX@C2 0ANQ^X/ X@C 2J h) 0AN^Xg/020 0Q`Q!22A o OI0bOb2/` 222  gZOb 1` K0K0`K0` `B ` ```bB ``R2C ڭB X c TD W0D0K0gZ 0RbZL0"@bZ١`b`ر2A ʭB c `HР ``W0I0Pgv` 2D B c@ A``Ug c5#30R 2 AC  %) d @C ` `Rg dsRP `#gcR D0f`f`290cC ] ``b2رcB S` Pа`Cа0g8C0EcB ݡ2A7"@`Р `!  `b 2@`D  `0b ZL0"@b` 0PT0` D0K0eD02 PC0c C03`y`hz8010*0 ``a2B `8UB0(2ڭ cHT`!cB c>` ]100Rл %й 80=B 00bB 00b0 00nX8PQX892^n9AR 9d O 928^R 8c:P*`_2Z?#nB4g 2!lQA4o/X2` '2^^ ld 8`*kC9>Z920> J 2IDZg8 9899O^9:PZA0 :^::"l:: D9B0 <80A0 lS `8<@<d$l 0G@0O 20ZU:QZA0 cH0*ScZyC^TAO W0@M@O!W&  ! `!`0@MIC@OW*0 2| PDIDZAP0@M:IC@OQZW #l `@@0>0G@: 22QJDZZU8 /g`@ d>T YN/H0`@Yg9T :W^*QZVcT2 2#x X$cT2 2#p P$hHL6$$F6`W6$$F(pHLL6$$F&W6$$F0cT2 2#h H$$fyPQRSqrptus1ONa ` aa `1a ``gH' 3540219&g-'/ g' g'/ g'/ #/o`flo`flo`fl #/   Lh HMH$&@Q#`I    2M^ QP & d%I4H L% L1$%$Ac`P =II< l LJHH0!<   +2h_+P  <I J2$%$B```` L K%IB`BR#2^sI;IB`I@T ;J#` <I L$410 L%L0$%$@QhhXR%2 T  HK` /2ZWQf0 #Q/`<<I 9I qIg'@A@0 ARN 20 ܄J HI!< Y  +2i_+P  <I J2%$B`oM L '`(!g 'g$flpqrstuI>qONO#  M L>H 2`Z"h i-.$'I  gTWNWO2[ d$543210iJD2Io$xx$/oM L `(!qIT g 'g$flpqrstuIVqONO`HI $@<#I%`U O#  M L>H 2`Zh (@-WvJ.$'I I  gTWNWO2$K dJ$543210iJD2Io$hh$/fg@H$J  J$@aH`V`AVH2$ BH (I`H$J  @$J  @$J $ H $ H(a$J  LH IJ$@$'&222H  lP/@ A0 2 22@  lP/H g `@02 CCC  lC/B0002P  d2/Rp8010P20CQ0 g `0g9 00 2P g9 d2/Rp 00 d 80` 0)002`2H P2C IC l/P  d l/002H 2C ICA0 l/ l/`p 1080 J  `"00Q2P J  002A H `J Q00 2`' 02B `b02@ @ ` P2H2 l  lH lP/@02g: /22g: /0 2 202gL D22z o/ZQZ2z ooo/D0`22  R  l lg/02  lg/B0`000!0 (00 0 080 0 00 gd/` 02g: XCB0g `3```HIJ  y`gP Bl3$J 0`$J C3$J cT$J CJ 1`THIJ  dy`gP Bl3J $!V$J C3$J !T$J CJ I!20@ 05BV@aJT 59V@L0052V@D5+VD0@T5"V@t5VJ `3J @Bl@"l@Bl0@o@l@"l.@"l@"l@"l2@"l@"l @"l6 @"l @"l J !`#J CJ !#@5UxJ 0I80 C J d 0!5 9OoJ ")@P8R8`` J CJ 3``0   B@`bN B fAR11R /I 0`J 0`c"lo8`#J `J J `xJ PBHဖ=oPB 0`!NUx`T 0x@ oP0JNaTQ dI@ဖH@@ 0Pn0 J P0INaAT dPBIဖB@@z@08J PH@ဖoSoP0JNaT dQI@ဖH@@y`YT nI J BP J  ` 0(2J `hJhk`X OJ  OJ O`Oa'V@5Qc280Dl.` `O00g`Z 2P zg l@5XUUVT@5YQ ``YJ @5HQ 80 @00" C0a8/M `BaE0(@(`ba(0(Vf@50"@@Q lHO0`R`Y t J` @7J @x7J j@7J h@x7 J j@7J hH` a `@ T , T )HSJ  @72 J  @7& J  @7 @A-2`! "8 0  @7YJ @8PJ @88YJQ I h >JC2J -^RR8 J `/ J `&& C 0@X8(JAhS '@Sx @l8Ir vJ hQ,J L  `bJ J R `b b   /!`</ 2 hJu.L " ,@ 0t80IgA"80AR@80FJ A80.R@80FE  cJ dJ E<2 J #2g ACAO@NAV(`   0`2(`J S!D, 2AC8TAO@MW gJ 4dJ 8`OAP@9NH 0gQ`7b adH 0!,b @(9fH2 )`'J <`J SJ` 0J 4J 82 @,9JHY KJ , 0RA aJ 8gJ HOPQPL0d0J    &@l9GJ ` "SCTCOBM@t9L0VG@9GJ (d!d  @9G@^GA aW)J 0PL P)J 0@N@C0N@C00NpA@9RC@P@@ @9!G b0@X8~GG@:dG2L K @$:RG  J  2!QTT @<:8GP`"GJ P@LX: ႇ3G! @h:IO)G AHO]LP`FJ @8G@8FAa @_J EJ (`J <``W! `!JP $J ,`@|`2`;4x090 @: 0F0g082 DV!C R" N0g@CHC)`2`A =1`8G0K0!dg"`J )@K0d"`c2lG0gL0"` @L0"`J ,@1d2`|*l[D0 @0L0"J 0P @5J0vCS0G0!JPg"`AScйc*Zr0~Q HC"HC d 2Qd. J` ႇa`"23    w 2`s `F j`,j AaMf J J  J  UK0B0d"`E 2`"%K0A"0vQ&22``Gl0``!^BHC@OANV O00hg"`@en0O0hg"``ee`лO00g"`e\`0O0g"`eS002`eKL0 lPA"0# 2 c!S [2T2 l ! c `! ` $l`! $l`` a!2m` !mc!OOAV@OAVAV`DAP0T@OOV OT@NVNV0K0"`e 2D0'*D"C [Qc04Ah @ d 20J a @98DA h@:A2B P!n J `AB0:$ |RJ  d@K; dC\AD0v52 A2`[ @``0` ` D0@dCD0A"`pd:D0Ad2`1hZ lcY ZL2DI0B0dA ,jA@iXJ a @9CNA ,jxJ \K X 00` |0 !2`0L0q $ZT0J X `c 2J \RQ A d A 0`J X2 L@ \S;c@ !* @;!U@ 2 J0  J` Xر`IJ X` \  I X @ ;B 2@4;C@@ @@5B@lqL0B@ D0A I \@L@;B0A@g L;500)K0 @80ho0C0f Q`O00f`H2 W2P z l*hS A0.2`$ L|0dA0.2` ;0 02` 4@X;L0`B0p@;JB0p@;4B0 02`I X$JT dQL \ @;? ! @;! @;`E?P`A0EX20090 -hg0g2 `ZO00g`G ׹2P z l(hD 2Q0 g2 BQ/A0d 02`/L \aA , J TQ @;? ! @;!>J T J l`L \' 00` `bб` bB00a J \`L \aA ʮA0bb`бJ \QA 00JA0 0RcJ \QA A0RcL \ $@;|> 80 & 0 b J@ \;3>J \A ;x80LGPg 2zaP d08x802`o08*CZA 2]C0C0 000dcDU0`dO 0:T#@OOOAVT@NAVUN0T2QVTOGO$lh8VCN0aVNT2V`T $l  M2`^D0K000 dM2h _bbbbbD0J ` 2 d(002T'O@OOV:T@NV`8`ONV805T@OOV=T@NV0NV`OU80UOFO0VGN*<8VNZVc2 ;:8l0D0I0Ou 2^b26J dAP0DT0dK0c 5 (O"o(dJ ᴮ J ḮJ ἮJ4 ᰮ@|p`"20T'BOOOVTBNVNVU0FOUO0VGN8VNVP`O``@`rW0 5 (O`fCD0J ĮQoq'J .^RR᥆J ` ᣆJ`!J 0+_Z80A0 22T0@OOAV OT@NAV0NAV`T $l 0 dM2`^D0000d 7dM2Z ` _DD0M᥆J J ᴮ8 J d ,ZB0'[fT0RM᥆J!` J 0+}_Z80A0NAla 2hT0@OOAV OT@NAV0NAV`mTT2 $l 0 dM2`^D000B0d 7dM2Z!` _DD0MᣆJ] J J h+ZB0Aጮa 2T0"@OOOAVT@NAVT0TOCOmNVBNT2yV$lVN0VT2$l` ZDD0MᣆJ1` ,gZA0Aጮa80ZB0eSMᣆJ)`R0p_000 P:T 0'@OOOAV:T@NJAVN `QVc:8 8 8 c, ᣆJd#: 0T@OOAV:T@NAVNJQV ᴮ : 0T@OOAV:T@NAVNJQV Ḯ`0@<=J `J Ἦ(0:F"DĮ2Qoq<"J <.^RR᥆J 0lh)"ᣆ 0Jdh!*[ 0D0&:T 0@OOAV OT@NJAV `NQV"8 8 8 8 J d`L0@lda*h!@< O0 P 0:T 0@OOAV OT@NJAV `NQVc8 8 8 c J dh@Ql`a`L @,<#="hb!@l9=J ᬮ !*[ 0D0:T 0@OOAV OT@NJAV `NQV+8 '8 #8 8 @L0dጮaW 22h`!JJ J h=!@H<<3!*Z 0C08::T 0#@OOOAVT@NJAV `NQV]8 Y8 U8 Q8 M99T0@OOVT@NVNW yaL Ah< 80K0 8Pe0Q2b`Z K0 e02b`ZL J  h @l<~/O0 P"d 0:T 0@OOAV OT@NJAV `NQVcr8 'l8 8 8 8 'Y : 0T@OOAV OT@NAVNQVCF L  !EQOU @(9; !U a;9T0@OOV OT@NJV NW!QP!dMP04J  A`tuL J 8P 0d:h  J ᬮ`"h 2JJD ᬮ `2FᰮKL2 0@` +J 0@N@C0N@C00NpA@RC<ȮCAȮ=@9J; D0a 80 D020 d L0!ER2L G[20@X8;@<;2@$:: 2 J  2!QTT @<::2z2@L< ႇ:! @h:IO: AHO]@J @<:Atu`J@udJ `J Į`J Ἦ @|`2`2$ʬ@C2ʬ0p2J00a`RC0Y`b` d30`Y`0q`GCi`0GO@CVB0p2002J80a`RC0rCi`B0BN0q`RC0Y`R` 0Y``0` ` x80`0` `0!"0)``8{ 2K !aID0!XO cUTBd0 M` g2 dP BT a   (FH@=9NH@=9}I@(=9B! @<=9D0z 0;0 `2` `SC0 P``C0`HC0UAaC0GCIaC0@C@OWQaC0@COWYaC0OW@F  @P=0R9!@x=0J9C0`"`C0BTz`C0B!DV@C ` @``C0(0`C000`C080`C0   P@C!eJW P@C!WcTP00d Pg@C!WcTeJQC0`BC0`BBC0` @C` (``C0S!TP`C0Br `C0``5H"'*    !`)` a` "A' "'  "'1BC0!`>BC0`9C0` `C0``C0``C0``C0A`aC0I`aC0Q``C0ya`C0 `baC0!z`0p@=>8``2C0 0 d[2dZ(` `>` 0C0"g d``C0 02GCZ @S0=0d8d(` dC0)`ayC0!"r` d!'7C0 `m(H`C0gB@gN=7   & `A` @= @> @$> @8>7 @L>7` @h>07@x>7`2Px210:0T`  d/D0!zC0BMD0!RC0c d0NAP M` 2 dP `D0 ``!Q ` @>L7 D0`H  `2P:80 a 2a2 O`2`d!A``\0D0#Add}AP~@DAزT@YA>C0`{?C0`I JL  "OPB0 DD0 ` `` @X.`J 8 `@>N62cOIQ2OR$@C2OR$2ORP$@C2HCOR$2ORP$B2OR$29 O  `  `R@`.A@>>")=6@>>22hO@0CZb$l/22hO@0aZ$l/22hO@0 bCZ$ @Cc l/`2 M`O Q2P$ d2 M`O Q2H$ d2 M`O 2BP$ Bc d`28 10:0`O)00 0"qO(000"jO0bC0b "H## &T"!PTC0b"C0b0 #HB0 NHC! ` T!PC00bC0b@C!` 8 C00 2c!p#OD0cbD0b8I``802c10:0O0 0"N(000"N0XgUz`<XQ PcabC0bk򼢯C0!cbC0 M 'c ' "H &T𰢯C0!bAC0t0bC00bZAC0tR T𰢯C0!PbC00bk򼢯C0`cbC0L0`bHcz`C02`xO0@0M 2`AT ) OZ`@V"H"0@0 0 #L@P0`G0g`0 dpYP PP@0?2 O) A0R{A0210`:0O"b  S!P ! ` Q `C0bC0qCb"C0!`b? = -"C0)`b?  "H0M8C0yCb= C0iCb 0AMC0ICb ` %O My`C0MTb"C01`b pC `g < !8  2 !` " "C0`bC0!pb"C0!`bC0b0H `  `~bC0b 2 P10:0OQ`"C0`bC0qCb"C0!`b? = 1"C0)`b?  "H0M8yCC0GMbC0yCb= C0iCb 0AMC0ICb ` %O MC0iCb"C01`b `W `R `  /: !H  pB/ != '` . "C0`bC0!pb"C0!`bC0b0H "C0`bC0ab"C0!`b`  `bC0b  80!2& N "&5 (H>Oc𰢯0!q @>2` c𰢯0!pcb`<0 bB 0b  0b0H0b@C(02)``OqaR `@g `;0:`P PP` I  hxPcA!":B ee :f(<8h 9:<*HZ*?L0Z0b4L2&UgT3 d: к:"Hh82@8"H 99HAR9; иh 89R; hP8P Q'¸ ? 5P:c)! `0`b` 8 !`:P@3  + @>1ڭ0Q:be ڭ0Q:`bh ZRZPW0|0g0PbPgl/`h C0`bS;Q0ڭ 0b8 0`bAT0Qڭ00:bG0\0fP0 00b8 gdg W0g\00 0Pb8Pg[/28BڭAARJP0:b; M8`@ (2LdWZBZ9H `h1G0Rg0PZPW0fP0b0? Q 8  2HJZ^`9 diP lT0i/ 58  "& !`#2` <s砡PBJP0P2QDl  2qAPq H^H 2AHAPA: !ָ;8 P0PZ2H0d d:; /Ǹ' 2APX j Z0b ;%d`&׺U  dZ0cbZ0b"HT `: O.0` x` {󰻡3s`2:010 `O" R@g00J(0"00JXg0Uz`:0`Q QQ`  `zPc] bC0b &T!PC00b`9 D_:SNrPC00b` Q  bC0b 8 ( d &T `  dbC0cbbC0b "HT  &T𰢯C0!P`b8 /C09z`2biZOW%000I"00~I2``ѻXAP| (R0 ``@P PP` g  PcC C0bI0bQ 7  &T𰢯C0``b`ӹZPC0¹bѹAPS` d ѻ  bC0b  "H+T `/C0`2 x)0?~O 0C zRS@!0`  ) ' `` g> z` PP0 0_zT <0z !! Y t&R@Pw>R!AR &!`BU' 91`C0:vd  J laC0cJaaC0AaP9 .Ty"!` C0{0{󰻡3s`; 2c!`#Obc𰚯D0!cb 290d#O!`cbD0d!`cbD0d!`cbD0!`cbc𰚯D0!cb22`O 0 0@g[T PcT PcYP Pccذ +0!E@ R;0@b0O@ 0b0T `_ @?0,`(U `( @߰M ` (D0"0M4F00h00 !' Pk"'!&OT"0b0L0`bH!`@S Q &T b0 dcbb0 0b/A`((B`cB `C0b0v0`Ob200`   Pc ``0 0B00 210:0#O 0 ڮD000R`@2 `O "U  `  A؈ I ဋ` J ᴄb @A <lఠ @A $T` @ᜄ` Aᄄ! I , J ,⾠ @A ᜅ @A 8ą @A d  @x bC0`bc`!C0bC0b@C໢C0bJ@C л `#DᴊJ2$dHѹX XȠO % "ɻC0bC0bBC`zT MT@A`@HN@M`UO@ذH`>8ɹY ذI.N`^U#"`3T 2X0@ҹ?* "0T B``  @ @*  ``B M`HC AMBdx`T !M"d`T Md0dH0g ٠ ``B M`HC AMBdx`T !M"d`T Md0dH0!%g   ``B M`HC AMBdx`T !M"d`T Md0dH0g ! `(` ` #BHTTV!J"" cT " "0HA@xH ! A؈I $J ᴊ  Bl/l dDd 2J I\A0O2Z @D@)C0bcb`! `(bC0 0bc񰢯!C0`bC0b@C C0b@Cѹ d @`@ 0)  ! RY@0H @x@ "J "  YP1  "H K@@)ck!J " %%$@!H@g &"R[@ !0 ( +Y` @` @ Aᬉ!( I !( J "( @@:) "HY"( PARgPHdg PRg! `y !SJ t.^RR  @@)IJ ` ᔡ ሢ!!"8  3 ! @8A( h! !! @A(h! J@ ᔡሢ"  @AI0(!oi)J .^RR  d  d  d       @A( !yJ .^RRXN HN @N  `!bC0cbk `!!'JY`AABh 4ᴐ@ٽ@CᴓIJAF ( Ԑ@DEGPIJA DM ሙC0LNH!(`e""C0R2O ) ȶ "H  "  ⵶ 2`0h0 `P20 2J .aZT8X1H4@0X2C Y d! #0```H0T@C V00\TPCNIC0 0V00PC0dXC0xC N N"`H0T@C V(0\TPCNIC0 (V(0PC0dXC0xC N NC0CxCCO`V`824"244 0XYAY:VV@C "024`SC0NX!U2TxC2NXUiC0NX2!TTXC#URpCOPCL"`0`T@C V(0PC0dXC0xCN N"`I0T@C V(0PC0dXC0xCN N`&`"`0T@C 1V0PC0dpC00xCNNhC22`IC@ZX`< `@ `C0 0H d N`C90 /B I0HC20H dE90I0HC /C 0XCHN40 d@C90 /xC c 0#2`2_H10P h@0 Z!#l/2h[@0[ DZZ lH0/X2_HP[2  !c l@0/`2x`y@> Og@ 0M0"@`Mѻ   `@5 G0.ghq0 (y EA0ҹb 80( @TF)&0 @F!&hC0 hZ`Ỹ@TGCI  0 M2"@FJ^I0@%0M")Z21`LT`Z% 0 M 2"@F^J0@%0 M") Z21`LT`Z Z21`LT`Z@VyP:` d l[0 /¹ӹ0`P PPS»ӻ[/`22 x`AU9H< O`0 $``;Z2#l< <! %H@5vСA0 ! d!%A@d $Q#l !H@R`5pСA0 ` 22PHһ;O ! h RK0@2 pH ``A{0P@C0@; »  g`hF@`0X0 "$ @ 0G d % g&%F@ 0@0@00QM)0@3w𰢹8`C0 ٹ07 0M2")1`MT`Z@V dK0Q  `@0MP PPd/2 2 @AP !H"0O F@gc ``9H hл!  %H@"$gUhz,0%d2 2``ZkJ 2`່?>0 0@000@Mp@00 2 2 !R@@HPѬ2JZ 2 lйQJ0 %! lH@Q%dh$2$l!9 @8GK0 $ 2@`GZ$ l`2VxO2`8y c8H%%9 D@$! 0 d:9 @G# @G @G0#0*"xD@`89:"20@BDJZ!l9Zl P88::8 8B H8gc 8@ ``(00M2`)TOZ@QT  R8 0@@ 99ZP dP@0Hc# c!x`AT   S `+B`;L ``>`` `C;>; ``6```C;>( `` `&``z`C;> ```Cc;; Pcc!0M>@?00M><*8(8Z[AD0("Mh9hHs `@g 0(8Z0MGCCUU d*PPZGpx29*0E0@00b 80 8(@XH"*ZQ0{<9S0@P?"20:@!xC0 0@Q@R@PP!@H=yH@80P28Z/ x8,0@ PgCHU0P@0@@!PPPB@Hh P2¬8QZ`50):MJPAP2h8`CR0@8T90 @Z 2rCT4oJZI4 2*Z020Z@2 CT Nd/*[`aD0g88`z@8L0B0 `: 80*Z2*8)PZ)qxyZF@0 Jb 80-:@H9:!888d88889: l P88-`2xhO ) ڻ'*#+ Pcb `"0@0 0 @x0A@P 00 @Hk!cF 2C `% =H ";;2 2 hk2C ZdZdH eH x0042 л0N C `H x0S04л0й22xO8H !$&% `xỆF@`ik0&0%d(H`H!2: U! R@ O0M2")1`JT`Z@8VyC@C=ء :0 H0@RhI0 O+0M2")1`JT`Z@8VyC@C2` lI0B4dB0 ء g g@ 0xM dแ%d4Q2(0O dG@!*"+0ڻ )@Hv 7 `0@  20P0 OhAk`]!2 `@0 @0A@P @IF )h!)cHcȹC ADDZP8 ZP8 `@ ZP8  2xS0* ZP8 2yT0 2yXCyCFHT0., RC zT0` 2S0` ZP8 T0 `NHG0񹺢 2`C y  0 0񹂹H `H 10T0' lN C `H 0S00 Yɹ lz lɻ dzX`0ٹA 0I0í02 O")H* @*@ἐ+J"AA0ᐐ? H"* A@ἐ*+, &! @AHl `*+, ! @A$,A0,20 0O#0gl80M 2")1`T `Z@`T@C   `     `0@\IL `R`$ c `J 00(090 0M`0 00+JQ QQ ̷W 2(0902< Bg2I`P/L0 @g/%2 'I``8`TA PcT@d d` lD0 /@g2g080L` ,`0:000 J  SJ ̷00P  k w eCQ` 80  ' @` b ` & h` Y ` 1 CQ `@!hIiJ ,DT2h J ,`k` 0 @Qg/L` ,/0g@W0L0,g6# 2 `a/G0gW0@L0,g6 2/! H`8`TA PcT@d d0'di/8`e/B0 2*Z`b08.XD `` D0c! @lIcv!`t!L00ɹC g`2C C;ae0K Ca Z0# e lP/P 0b0 ` d Z` ^hQ *`Z8-028, 00,``8, g8C#\ Cg> 0   u  , dp 8C;aC"\e`e #a`C"\[ `[ 8CCa!{`;-O o"aD `IF 8CKa"}@[08-Rg` 2*8-PZZ2 d/*WZQ0JP2`A08,28,B  D  loC  8C;aC"\` o 0D p D `*WZ*ZhHaJ`  lHaI`/H ZD4ZQH l2aK`  lH (aJ`/H zh`S @I`C *8o 2D @I9o bS @I! A| H @Ic J*Z⬹S0D0b c(9.AT9.  2 . 8.@I h`W@I ``R`!80@J (07 5@ J09 `"g`   `` 'd c /@0J0  P` 0` @8J. 80` @A,Է ` 0 @@J? @`J @Է0 2D J Է`/ 2)020@I @pJ!` 2`$l\2  08 d$l`x`@K2L` ,C X"n h@y"@,„!!T0%@OOOV)T@NVN@'VV@Kg a!T90@OOW)T@NWNW`a&@A`,0㱮8@$KI z!TQ0@OOV)T@NVN W00`㕮bT0AOOVjTANVNV@4K" 1`@DK '2!T0@OOV OT@NVNW @TK`7 0dㆩ2`C / `' L0C00b2`K0c2ZX `R``T0 R 0` L0 d l`/C0{x` OP``80@dK0080@0K 0l@Ka@K@K@K!@Ka@K@LHhC aaZ@LJ l*hS @ L0`@0L!6` 220` @I ` ``X 2@ML00K0!dgd 0`8@,M0x@90J^0 8 2@aPT0e@P` ,2J /^RRBP# BQ B Q BQ BQ B Q B(Q B0Q` ATh T @S& H  @OP 2dlT Z l/"HZ l /2D0 HdL0 @T1 @0h`Jgf T0c 0@0T Z:2L0etR@!`0F0 @TTc 2`(R0$`x@K2L` ,`B P!n `b J  :P``Y(0@tT 0KK@ 0"@, Ľ![0T0$@OOOV!T@NVNF'VV2@T! aS0T90@OOW!T@NWN*@W`Ac`,R0zr0x8@T"0Qs01T0@OOV!T@NVN`V r&@dS0r`PrT0AOOVbTANVNV@T!@S`2@T[  )  L #`'H J T ZI:``0HTAOOV!OHTANVNV"2 A4RQ, T 0@OOAV OT@NAVNQVqCXTR SGdS2"l"l 'd @zUac! 0  ,Z "2T 0#@OOOAVT@NAV0NAV) @,UQ<J rT0AOOVZTANVNV0r㳼; @P? ĺQ d @U00 @]0J ,QT90@OOW OT@NWNW@0TM"2B( 0]b a90T@OOW OT@NWNW@M02(b`@V `? 0o 2qaKF ᐑ S H I0 H Oq@L04VAd"ᜑ`2&dJb@HVg #lP` dL ᨑ T ` 210"0AQ )00@NND0AV!NT RS 8G00`gd 0 'Q/@] $2>0 ": @]L0 Q$l/ CC01C/P` `28 :0{ @I ` ?DJ lpT2I!` (0`w`X`yJ ԸP 2@P\L0e `@X\!  @`\! @h\!M @]s 80  J ,Pia D0hR (P/0 #G,O00g`(00S !` &  & &L0 )P J lT2`0y10`T0y10 `F 2"0 @I `- ```J ԸQ``8000`)Q(00@]0g  ``2`:0 2` 00 @I! ` c zP`R`'@  dD0㶸 `"280` 10`2``a 2``PX !R+00`@*0b< ~$ ``7 `2AbW0. P` J R S$РPN@b` H$A0f F J  @b /$J @ c`R "$2`R` J R @c @,c` @ APgճ 2K0`л@TgG0g`x `7` `00@ 5!0:0;  ` `` J    9.  + ZPa@0J0 B0`` J  `X`t J @0癠"㰷 2@IW` 0㜺 00`J  0Gg0㮷@d70{J  0Gg0㛷@p70hJ ćP @ iJ0ZJ ᄇP @,iJ0LJ  0Gg0l@509J  0Gg0Y@70&J  0Gg0F@8i0J P @@iJ0 `.L 0d@U  APg㸲 `@Hi!G0g`0 `(0008`0`0`0` 20  db0b@C 00E n70dL (b0b@C `002"0`0 '2 I L 3 l 2D0Jb@C 00 80`0 d  20c2d lJb C 4`0 |0dE( 20Jb@C cJ ,@lw `@An``*0`&2#l \a!C  C \ `"c` l 0 0/d P``qa00Eᐘ 2`S0#80J LS ᐘ0!0㻮  l0 dJl T 0 D0 ` 20`VA@ᐘ S@᪪M᫪@2!2`JD"lDf0dd2dD0l>0g hC0`$2ba X !` a l d$lC `2Za D D0 d`4 `1 `-82#l^ 2D  a`  @n `P` @n `d#l0!22`cD +S'B b 0!J ᜑ^C TK  jPj j аj`@jpP c0I*[W0yd0D0D02Q J ᜑ^RҮRc2Q J ᜑ^RRc2Q J ᜑ^RCR20Q J ᜑ^RRRI*[W080dD00L0hH`$hH` i HC`00hH`0PI*[W0yd0D04D0I*[00D0 0 D0J ܸ (   J ظ` `J ܸ0J ظJ ظ`: 80)0 ` ' %`` 0 20L0Adぬ  T 0L0xdL ᨑ  c`(`Eᨑ2`h` 2)202HD H rdC0 D    0`1`0-D `L0'hJhL@Lo ᜑ! @To @cAd@toa @|o @cAd@o @o @cAdKL` ᐑ ᜑ!Add `J ᨑ0``xJ ᐑ`gP a2J ᨑ  A`oc+ 0gfa`0G0Aof_`J0@ @ @X @@ л0`8J ᨑ`J 0TL0`!d㥒 2( A0m J ᬑZ@C2( ꭊZ J ᬑZ0( P @ᬑP`LO㋍ 0 J@8 (( @o ``O B Aᬑ"| d8`(  dOHPW0`g``JO 0`O``JO 0`O`% `_0`"O`P`$h @w0` T080fO=JP`0000͑2}S 0[  ` `* `+`` DЌhhj@^ lhQ @j@j@jP@jH쐳@jг@jLFв@j|@jG`x¬4)020J0BP'0 gg1 / -(B0 % #` *(PZP2blB0Pg  0H`0H` dB"l l J |0 Ѡ Pg B0`Qx020)0g 00 2`U C @`O `M 0K $2\ G2!P4`BoL2alP0B0J  T0P2(  dB!l*[\ $2  !PS7 >yD00 0x8P*S}Qx[\ `A`1    RD  !`> a) `5 !@$!%, @0p# @Lp @`p @p @p @p @p @ qA@8q0q"00Z80@`V 2D   D0'f 0nD0k` 2D  ]D0W2P 290f ` 0 0i  ` 7 g0P`Rգ `0x80`2A @ILJTS`PаP`P `A082RR220<\e0d` * `z`⠐+C !d`P@ !d`P@S yP@C0ds `PZР8Pа>  `   Z @J0@)PdL2 @J0)P( Z&Pg@J0>0Pg 0@ 2R d@ZJ0ddK Z @J0@9Pd> @J09P@d`ZP PP` `lx: 200 `  JSJg@ 2@ZJ0d89 2 `  JQJg@2ZB0d2d2R2RP@APqB` `O 80!0,M,k%0 000@S22 0^EQ\A080H` gd@Xq0 @`q0 T0@Chq022aH` lH!x 2J 4afZT `  B`  R` 0@Q l XC 2J 4 DZT HCf HC0gACIf @ A02kaPB0B0dC2hAf@CI` H 2^A\n/B02J@5H pqq%H10?|ںLga `aHa` H iaC HXa Hag-H `g A`0g8 hah 0ZȺ 2ȸl0Ⱥڸ"[00  ȸ@0 `T S0 ga / -H@`a `aڸ!%H 0 g/0H0 ga/@0 o*ZZ/0 ga/A0 2 02:0H 3 C*a`J2 l[a aa kaa  %J/J/J/-J/J/ 0f@CJ` cG0@e00 CSa 2 l'd C%JPqacJ0 d0f@CK` G0@e0 CRa2 d'd `P"hc"d*dQP"nQhp g( *aoequ "do*dlm "s$ g]!p@_ "ugdTW %Hg a/2'dg sa/2@q 0'dTD D0㌟%H00 ga/`  d/0 gOa/> F`J23u'dC0`< 20 dS0bRR806 +a3 Ah 5Jh J (aC # o "l2'd h2 H'dB 0 d2803uC0Q02B0d2.`S0"R:W0dO0ad:P`G 5 (O.```^J @NqJ@qD@q>`j``jOбjСx80| ʠ @`J  l`bo$@`8֡J  `"ll$@`¡J  $@`ⳡJ  $@`⣡x80JxC $J PHJ PIJ P(HBl8PxJ (`$J PHJ PIJ P(HBlPo`$J PHJ PIJ P(HBlP808C8x`H5H1H-H)H%H!HHHHH H HH` @wd @0r`8x`fI5bI1^I-ZI)VI%RI!NIJIFIBI>I :I 6I2I` @wd @Lr`80c@ 2`  0BPM`"28010J `$J PHJ PIJ P(HBlP0N@Co$J PHJ PIJ P(HBlP0@N@Co$J PHJ PIJ P(HBlPxCo$J PHJ PIJ P(HBlP`J `$J P(HBlP d/9` 2 \20 @OV@O0V0S0 2@ \!@OOAVAV02!W0OJP @lrL0 8[|0!W0gO0JP @r0`!=8 50cO_0 `O0OPc0P D0>0os T l0#RP29R2J Z dZ %0`$=0 O@r~y J  $J PHJ PIJ P(HBlP0N@Co$J PHJ PIJ P(HBlP`o$J PHJ PIJ P(HBlPxCo$J PHJ PIJ P(HBlP#J `%0ZOO:;0`? @r ` J `$J PHJ PIJ P(HBlP0N@Co$J PHJ PIJ P(HBlP0@N@Co$J PHJ PIJ P(HBlP`Co$J PHJ PIJ P(HBlP`2J d$J PHJ PIJ P(HBlP d  f4 80@r?0 :P; P :Q;6 j@r0$ de.8c0DP@gr@o82 `O   (`0` ` `J `OPP$J PPI$J 02PPLlPPJoPPLoPPL$@x `@ H`J ,QT0@OOV OT@NVNW@0r@UL 0` D0"k`|0Û 㧛 20Rp8010㧛 0wP 0wP00220B4`:VANVYVI02o pgT 20 d`g/ 2 2o@^ѠPW02 D0go   " !`A` AC XBx  `Y ` `0 2 2o@^ѠPW02$D0go   ) !`A`" T@C XyTB T [TT`` `0 2 2o@^РPW0D0gIo    !`A`  x й W2oQI$ 2'U" 10o D0o " UD002`)0k 0 0f `㾚X   ]  !` W )C0 0`+ J 2W0C0!@g^Ԭo   5 !`A`. PT ThIC@C `zPT`ThBB !hTQT &g"cUUTTh h hB0 `80X   })C0 0` s 2@ t9G`^Ҡna 0C0` @,t9 0`C0 2@Ht9^ҠP 0C0``/a 0C0` @tt'` `C0 0`~ @thC0 0`o @t'`@` 0C0`_ @t 0C0`0290 `O20`@t  @t`  `'2Z( 0d lD00  @t P`'27 [Z( RX   7  !`1 PL0C0`=aC0L0`6  C0L0mo ! "UC0L0 C0L0ZaL0C0`AXc]C0L0l  ` paI lD00 /@4uO0(0 @A|P2` ݰo `p`o :`C0`)C0`"U*QC0``4  R`C0`* !YC0`` pOACpo /oOoA`@C !`BaC0 X`C0`XB !` X @EQ . @o8 W0C0!8JP`e" `@xtc2 2 `ca]л # @` " #@ "@(w ' P70800@bR @2w 00*@y$ ؠ @o ࠀCTӹ>ࠀCT80л00`M"MD000b  ؠ ` @xx0ҹ  ӹQ0`Q QQѹP`9 90 CTҹ/ _0@gᨹ`p3"CD0 00b o Aᨹ!𹱹APES $W0C`g2 0s"GD00b 0O A𹱹APESؠ _`/R"d`D`0yù00 @jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-%n%%7.7Z7777&@))j**+.56D6@/222z33l44 505\]\]\\]]\]X]^^_*_^lrvrrsNssttuuu|v.wxwnandnand_select_chip̟P** N vvpppjUVY ZZ YVUe03fBLR%KPC: %08lx SEQSTAT: %08lx SP: %08lx R0: %08lx R1: %08lx R2: %08lx R3: %08lx R4: %08lx R5: %08lx R6: %08lx R7: %08lx P0: %08lx P1: %08lx P2: %08lx P3: %08lx P4: %08lx P5: %08lx FP: %08lx A0.w: %08lx A0.x: %08lx A1.w: %08lx A1.x: %08lx ?file errorstream errordata errorinsufficient memorybuffer errorstream end0.95Punknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkinvalid stored block lengthsinvalid block typetoo many length or distance symbolsoversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeinvalid bit length repeatoversubscribed literal/length treeincomplete literal/length treeinvalid distance codeinvalid literal/length codeincorrect data check Exception: IRQ 0x%x entered code=[0x%x], stack frame=0x%x, bad PC=0x%04x Unhandled IRQ or exceptions! Please reset the board Exception! ethaddripaddrloadaddrbootfilebaudrateMay 5 200705:46:05%s (%s - %s) U-Boot 1.1.5Clock: VCO: %lu MHz, Core: %lu MHz, System: %lu MHz SDRAM: ### ERROR ### Please RESET the board ### ## Warning: gatewayip needed but not set netretrynoonce ARP Retry count exceeded; starting again %d.%d.%d.%dbad length %d < %d invalid RARP header len bad %d < %d checksum bad ICMP Host Redirect to none%dgatewayipnetmaskvlannvlanserverip*** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Using %s device Abort Bytes transferred = %ld (%lx hex) %lxfilesize%lXfileaddrLoad address: 0x%lx Loading: *octettimeoutFile too largeFile has bad magic %lu MB received TFTP error: First block is not block 1 (%ld) Starting again done TFTP error: '%s' (%d) Starting again Retry count exceeded; starting again %02lX%02lX%02lX%02lX.img*** Warning: no boot file name; using '%s' TFTP from server ; our IP address is ; sending through gateway Filename '%s'. Size is 0x%x Bytes = *** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathNIS Domain NameautoloadNFSBOOTP broadcast %d RARP broadcast %d ethactNo ethernet found. ethprime [PRIME]eth%daddr Warning: %s MAC addresses don't match: Address in SROM is %02X:%02X:%02X:%02X:%02X:%02X Address in environment is %02X:%02X:%02X:%02X:%02X:%02X unknownTimeout *** ERROR: Cannot mount *** ERROR: Cannot umount *** ERROR: File lookup fail /*** ERROR: Symlink fail /nfsroot/%02lX%02lX%02lX%02lX.imgFile transfer via NFS from server Filename '%s/%s'. Load address: 0x%lx Loading: *rx fifo error rx crc error rx length error rx length too big dm9000 not found at 0x%08x id: 0x%08x dm9000 i/o: 0x%x, id: 0x%x MAC: %02x:%02x:%02x:%02x:%02x:%02x Cant set MAC addr[%i]: write %02X read %02X operating at 10M half duplex 10M full duplex 100M half duplex 100M full duplex could not establish link unknown: %d mode transmission timeout DM9000#%d%lu MiB nand_base.cBUG: failure at %s:%d/%s()! BUG!Timeout!Reading data from NAND FLASH without ECC is not recommended nand_write_ecc: Attempt to write not page aligned data Writing data without ECC to NAND-FLASH is not recommended nand_erase: attempt to erase a bad block at page 0x%08x NAND device: Manufacturer ID: 0x%02x, Chip ID: 0x%02x (%s %s) NAND bus width %d instead %d bit No NAND device found!!! %d NAND chips detected nand_scan(): Cannot allocate oob_buf nand_scan(): Cannot allocate data_buf No oob scheme defined for oobsize %d 2048 byte HW ECC not possible on %d byte page size, fallback to SW ECC 512 byte HW ECC not possible on 256 Byte pagesize, fallback to SW ECC NAND_ECC_NONE selected by board driver. This is not recommended !! Invalid NAND_ECC_MODE %d No ECC functions supplied, Hardware ECC not possible ToshibaSamsungFujitsuNationalRenesasST MicroUnknownNAND 1MiB 5V 8-bitNAND 2MiB 5V 8-bitNAND 4MiB 5V 8-bitNAND 1MiB 3,3V 8-bitNAND 2MiB 3,3V 8-bitNAND 4MiB 3,3V 8-bitNAND 8MiB 3,3V 8-bitNAND 8MiB 1,8V 8-bitNAND 8MiB 1,8V 16-bitNAND 8MiB 3,3V 16-bitNAND 16MiB 1,8V 8-bitNAND 16MiB 3,3V 8-bitNAND 16MiB 1,8V 16-bitNAND 16MiB 3,3V 16-bitNAND 32MiB 1,8V 8-bitNAND 32MiB 3,3V 8-bitNAND 32MiB 1,8V 16-bitNAND 32MiB 3,3V 16-bitNAND 64MiB 1,8V 8-bitNAND 64MiB 3,3V 8-bitNAND 64MiB 1,8V 16-bitNAND 64MiB 3,3V 16-bitNAND 128MiB 1,8V 8-bitNAND 128MiB 3,3V 8-bitNAND 128MiB 1,8V 16-bitNAND 128MiB 3,3V 16-bitNAND 256MiB 3,3V 8-bitNAND 512MiB 3,3V 8-bitNAND 256MiB 1,8V 8-bitNAND 256MiB 1,8V 16-bitNAND 256MiB 3,3V 16-bitNAND 512MiB 1,8V 8-bitNAND 512MiB 1,8V 16-bitNAND 512MiB 3,3V 16-bitNAND 1GiB 1,8V 8-bitNAND 1GiB 3,3V 8-bitNAND 1GiB 1,8V 16-bitNAND 1GiB 3,3V 16-bitNAND 2GiB 1,8V 8-bitNAND 2GiB 3,3V 8-bitNAND 2GiB 1,8V 16-bitNAND 2GiB 3,3V 16-bitAND 128MiB 3,3V 8-bitnand_bbt: Error reading bad block table nand_bbt: ECC error while reading bad block table nand_read_bbt: Reserved block at 0x%08x nand_read_bbt: Bad block at 0x%08x create_bbt(): chipnr (%d) > available chips (%d) Bad block table not found for chip %d Bad block table found at page %d, version 0x%02X nand_bbt: Error reading block for writing the bad block table nand_bbt: Error during block erase: %d nand_bbt: Error while writing bad block table %d No space left to write bad block table nand_bbt: ECC error while reading block for writing bad block table Bad block table written to 0x%08x, version 0x%02X nand_update_bbt: Out of memory nand_scan_bbt: Out of memory nand_bbt: Out of memory Bad block table at page %d, version 0x%02X bootretry ## Command too long! ** Too many args (max. %d) ** Unknown command '%s' - try 'help' Usage: %s 'bootd' recursion detected prebootbootdelaybootcmdHit any key to stop autoboot: %2d %2d ip04> Timed out waiting for command ## Error: "%s" not defined autoscrautoscr - run script from memory [addr] - run script starting at addr - A valid autoscr header must be present verifyBad magic number Bad header crc Bad data crc Bad image type Empty Script ## Executing script at %08lx bdinfobdinfo - print Board Info structure %-12s= 0x%08lX boot_paramsmemstartmemsizeflashstartflashsizeflashoffsetethaddr =%c%02X ip_addr = baudrate = %d bps resetreset - Perform RESET of the CPU gogo - start application at address 'addr' addr [arg ...] - start application at address 'addr' passing 'arg' as arguments ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... ## Transferring control to RTEMS (at address %08lx) ... imlsimls - list all images found in flash - Prints information about all images found at sector boundaries in flash. iminfoiminfo - print header information for application image addr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums) bootdbootd - boot default, i.e., run 'bootcmd' boot - boot default, i.e., run 'bootcmd' bootmbootm - boot application image from memory [addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image Image Name: %.*s Image Type: Invalid OSNetBSDLinuxVxWorksQNXU-BootRTEMSUnknown OSUnknown ArchitectureInvalid CPUAlphaARMAVR32Intel x86IA64MIPSMIPS 64 BitPowerPCIBM S390SuperHSPARCSPARC 64 BitM68KMicroblazeNiosNios-IIBlackfinUnknown ImageInvalid ImageStandalone ProgramKernel ImageRAMDisk ImageMulti-File ImageFirmwareScriptgzip compresseduncompressedbzip2 compressedunknown compression%s %s %s (%s) Data Size: %d Bytes = Load Address: %08x Entry Point: %08x Contents: Image %d: %8ld Bytes = Image at %08lX: Verifying Checksum ... Bad Data CRC OK ## Checking Image at %08lx ... Bad Magic Number Bad Header Checksum Error: Bad gzipped data Error: gunzip out of data in header Error: inflateInit2() returned %d Error: inflate() returned %d ## Booting image at %08lx ... Bad Magic Number Bad Header Checksum Bad Data CRC Unsupported Architecture 0x%x Standalone ApplicationWrong Image Type for %s command XIP %s ... Uncompressing %s ... GUNZIP ERROR - must RESET board to recover Unimplemented compression type %d autostartCan't boot image type %d bootargsconinfoconinfo - print console devices and information List of available devices: %-8s %08x %c%c%c %s eepromeeprom - EEPROM sub-system read addr off cnt eeprom write addr off cnt - read/write `cnt' bytes at EEPROM offset `off' read EEPROM @0x%lX %s: addr 0x%08lx off 0x%04lx count 0x%lx writeitestitest - return true/false on integer compare [.b, .w, .l, .s] [*]value1 [*]value2 -lt<-gt-eq==-ne!=<>-ge>=-le<=Unknown operator '%s' Invalid data width specifier Total of %ld %s%s were the same mtestmtest - simple RAM test [start [end [pattern]]] - simple RAM read/write test looploop - infinite loop on address range [.b, .w, .l] address number_of_objects - loop on a set of addresses basebase - print or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off' crc32crc32 - checksum calculation address count [addr] - compute CRC32 checksum [save at addr] cmpcmp - memory compare [.b, .w, .l] addr1 addr2 count - compare memory cpcp - memory copy [.b, .w, .l] source target count - copy memory mwmw - memory write (fill) [.b, .w, .l] address value [count] - write memory nmnm - memory modify (constant address) [.b, .w, .l] address - memory modify, read and keep address mmmm - memory modify (auto-incrementing) [.b, .w, .l] address - memory modify, auto increment address mdmd - memory display [.b, .w, .l] address [# of objects] - memory display %08lx: %08x %04x %02x %cbyte at 0x%08lx (0x%02x) != byte at 0x%08lx (0x%02x) word at 0x%08lx (0x%08lx) != word at 0x%08lx (0x%08lx) halfword at 0x%08lx (0x%04x) != halfword at 0x%08lx (0x%04x) bytehalfwordZero length ??? Copy to Flash... done Base Address: 0x%08lx Pattern %08lX Writing...%12sReading... Mem error @ 0x%08X: found %08lX, expected %08lX ? CRC32 for %08lx ... %08lx ==> %08lx sleepsleep - delay execution for some time N - delay execution for N seconds (N is _decimal_ !!!) NOT device is %swrite protected TIGHT LOCK UNLOCK %08x - %08x: %8d pages %s%s%s NAND flash successfully locked Error locking NAND flash. NAND flash successfully unlocked Error unlocking NAND flash. Write and erase will probably fail nbootnboot - boot from NAND device loadAddr dev nandnand - NAND sub-system info - show available NAND devices nand device [dev] - show or set current device nand read[.jffs2] - addr off size nand write[.jffs2] - addr off size - read/write `size' bytes starting at offset `off' to/from memory address `addr' nand erase [clean] [off size] - erase `size' bytes from offset `off' (entire device if not specified) nand bad - show bad blocks nand dump[.oob] off - dump page nand scrub - really clean NAND erasing bad blocks (UNSAFE) nand markbad off - mark bad block at offset (UNSAFE) nand biterr off - make a bit error at offset (UNSAFE) nand lock [tight] [status] - bring nand to lock state or display locked pages nand unlock [offset] [size] - unlock section quietinfoDevice %d: %s, sector size %lu KiB no devices available Device %d: %s No such device Device %d: %s... is now current device erasedumpscrubmarkbadbiterrlockunlock Device %d bad blocks: %08x clean NAND %s: device %d whole chip NAND %s: device %d offset 0x%x, size 0x%x Warning: scrub option will erase all factory set bad blocks! There is no reliable way to recover them. Use this command only for testing purposes if you are sure of what you are doing! Really scrub this NAND flash? scrub aborted .oobNo memory for page buffer Error (%d) reading page %08x Page %08x dump: %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x OOB: %02x %02x %02x %02x %02x %02x %02x %02x NAND %s: device %d offset %u, size %u ... .jffs2.e.iOKERRORwritten %d bytes %s: %s block 0x%08lx successfully marked as bad block 0x%08lx NOT marked as bad! ERROR %d tightstatusbootdevice ** No boot device ** ** Device %d not available Loading from device %d: %s (offset 0x%lx) ** Bad Magic Number 0x%x ** ** Read error on %d yesAutomatic boot of image at addr 0x%08lx ... pingping - send ICMP ECHO_REQUEST to network host pingAddress nfsnfs - boot image via network using NFS protocol [loadAddress] [host ip addr:bootfilename] rarpbootrarpboot- boot image via network using RARP/TFTP protocol [loadAddress] [bootfilename] tftpboottftpboot- boot image via network using TFTP protocol bootpbootp - boot image via network using BootP/TFTP protocol hostnamerootpathdnsipdomainAutomatic boot of image at addr 0x%08lX ... ping failed; host %s is not alive host %s is alive runrun - run commands in an environment variable var [...] - run the commands in the environment variable(s) 'var' saveenvsaveenv - save environment variables to persistent storage setenvsetenv - set environment variables name value ... - set environment variable 'name' to 'value ...' setenv name - delete environment variable 'name' printenvprintenv- print environment variables - print values of all environment variables printenv name ... - print value of environment variable 'name' Environment size: %d/%d bytes ** Abort stdinstdoutstderrCan't delete "%s" ## Baudrate %d bps not supported ## Switch baudrate to %d bps and press ENTER ... eth## Error: environment overflow, "%s" deleted Saving Environment to %s... ? - alias for 'help' helphelp - print online help [command ...] - show help information (for 'command') 'help' prints online help for the monitor commands. Without arguments, it prints a short usage message for all commands. To get detailed help information for specific commands you can type 'help' with one or more command names as arguments. echoecho - echo args to console [args..] - echo args to console; \c suppresses newline versionversion - print monitor version %s - No help available. Unknown command '%s' - try 'help' without arguments for list of all known commands In: No input devices available! Out: No output devices available! Err: No error devices available! Cannot initialize the list of devices! serial*** Warning - bad CRC, using default environment EEPROMTimeout writing to Flash Flash not Erased Can't write to protected Flash sectors Outside available Flash Start and/or end address not on sector boundary Unknown Vendor of Flash Unknown Type of Flash General Flash Programming Error flash.c%s[%d] FIXME: rc=%d %s %2ld.%ld %cB%s0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZCPU: ADSP BF532 Rev.: 0.%d Board: IP04 IP-PBX http://www.rowetel.com/ucasterisk/ip04.html Timeout in Wait_For_WEL Timeout in Wait_For_WIP_Zero Invalid start offset 0x%08X Invalid end offset 0x%08X SPI Erase block error SPI Write Time Out SPI Program Time out! 0x%08XStarting Kernel at = %x missing or unknown FLASH type CFI conformant FLASH (%d x %d) Size: %ld MB in %d Sectors Erase timeout %ld ms, write timeout %ld ms, buffer write timeout %ld ms, buffer size %d Sector Start Addresses: (RO) %08lX%sFlash %s error at address %lx Command Sequence Error. Flash %s timeout at address %lx data %lx Block Erase Error. Locking Error Block locked. Vpp Low Error. Can't erase unknown flash type - aborted - no sectors to erase - Warning: %d protected sectors will not be erased! done %d erase regions found, only %d used ## Unknown FLASH on Bank %d - Size = 0x%08lx = %ld MB Eeep. Autoplacement selected and no empty space in oob %s: MTD get bad block failed: %d Skipping bad block at 0x%08x %s: MTD Erase failure: %d %s: MTD writeoob failure: %d %s: this erase routine only supports NAND devices! Erasing at 0x%x -- %3d%% complete. Cleanmarker written at 0x%x.Can't pad when oob data is present. Unknown flash (not normal NAND) YAFSS cannot operate on 256 Byte page size Input block length is not page aligned Image %d bytes, NAND page %d bytes, OOB area %u bytes, device size %u bytes Input block does not fit into device Bad block check failed MTD writeoob failure: %d writing NAND page at offset 0x%lx failed Bad block at 0x%lx in erase block from 0x%x will be skipped Writing data at 0x%x -- %3d%% complete.Data did not fit into device, due to bad blocks Input block is larger than device Reading data from 0x%x -- %3d%% complete.Could not read entire image due to bad blocks reading NAND page at offset 0x%lx failed MTD readoob failure: %d nand_get_lock_status: Start address must be beginning of nand page! nand_unlock: start: %08x, length: %d! nand_unlock: Device is write protected! nand_unlock: Start address must be beginning of nand page! nand_unlock: Length must be a multiple of nand page size! |# (p%BD $ %K | |(|(|0|0|8|8|@|@|H|H|P|P|X|X|`|`|h|h|p|p|x|x|||||||||||||||||||||||||||||||||}}}}}}}} } }(}(}0}0}8}8}@}@}H}H}P}P}X}X}`}`}h}h}p}p}x}x}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~ ~ ~(~(~0~0~8~8~@~@~H~H~P~P~X~X~`~`~h~h~p~p~x~x~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  ((0088@@HHPPXX``hhppxx <3]22 33,3]H3??       !1Aa  0@` #+3;CScs@@@@@@@   0 @@@@@@@@@@@   0 @@@@ 0@P`p 0@@@@@@@@@ &()*+,-./0123456789:;<=>?B B(B0B